PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g009360.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 262aa    MW: 28540.7 Da    PI: 9.4411
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g009360.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-382786261
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        k++ ++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rkn++ 
  Sopim10g009360.0.1 27 KDQVVNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNRRC 86
                        78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-292085IPR003851Zinc finger, Dof-type
PfamPF027019.8E-332885IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.913185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MATQIAPPNV TCSRTSTTME KKVRPQKDQV VNCPRCNSTN TKFCYYNNYS LTQPRYFCKT  60
CRRYWTEGGT LRNVPVGGGS RKNRRCSISS SSLSSISSSQ KLLDLNPNPS LSSLQNPNYN  120
LNLGSNQDLN LGFPSFNIHN HNNYFRGMPQ FLDFPKMDKG NNGINHFSTS TSNTSPVSAL  180
DLLQKGIASR GLTASISSSS SPSTPDLNAL YTSSEVQENG AKMMLPFGCL NNHNNSESKG  240
QENSSSVGFW NDGMLGGGGT W*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248087.10.0PREDICTED: dof zinc finger protein DOF2.5-like
SwissprotQ433855e-43DOF37_ARATH; Dof zinc finger protein DOF3.7
SwissprotQ9ZPY07e-43DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLK4CYB20.0K4CYB2_SOLLC; Uncharacterized protein
STRINGSolyc10g009360.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.45e-42Dof family protein